PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002272.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 261aa    MW: 29440.9 Da    PI: 7.7271
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002272.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.55.9e-3250106259
              ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              +++rYkeClkNhA+ +GghavDGCgEfmp+ geeg+ ++lkCaAC+CHRnFHR+e +e
  Itr_sc002272.1_g00005.1  50 TNYRYKECLKNHAVGIGGHAVDGCGEFMPA-GEEGSFDGLKCAACNCHRNFHRKEAAE 106
                              5789*************************9.999********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.4E-2852104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2153104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-2953103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.34854103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.1E-5168207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEMEFDEERE EEMEMEEIEE AGDYQTPAGR GLEGAPARKS GGGSAAAATT NYRYKECLKN  60
HAVGIGGHAV DGCGEFMPAG EEGSFDGLKC AACNCHRNFH RKEAAESEGY ARHQSPPHHH  120
HNLHPIHHHH HFSTFSSYRA PHPSGYLHVT PPSHHRQLAL PSSSRDEEDM SNPSSSGGGS  180
KKRFRTKFTA EQKIGLLPVI IYKKWSTRII RDSHLRNASL VLYETRTRLA FRKCESATIL  240
FAYEKCVWRI THFPYANMVV R
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571526.14e-55PREDICTED: zinc-finger homeodomain protein 2-like
TrEMBLA0A068USE63e-52A0A068USE6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000336241e-50(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.17e-37homeobox protein 22